PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT1G79180.1
Common NameATMYB63, MYB63
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family MYB
Protein Properties Length: 294aa    MW: 33780 Da    PI: 4.7965
Description myb domain protein 63
Gene Model
Gene Model ID Type Source Coding Sequence
AT1G79180.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding50.93.5e-161663148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg+W++eEd +l+  ++++G ++W++ ++  g+ R++k+c++rw +yl
      AT1G79180.1 16 RGPWSPEEDIKLISFIQKFGHENWRSLPKQSGLLRCGKSCRLRWINYL 63
                     89******************************99************97 PP

2Myb_DNA-binding551.9e-1769114148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg++T eE+e ++++++ +G++ W++Ia+ ++ gRt++++k+ w+++l
      AT1G79180.1  69 RGNFTSEEEETIIKLHHNYGNK-WSKIASQLP-GRTDNEIKNVWHTHL 114
                      89********************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129415.2071163IPR017930Myb domain
SuperFamilySSF466899.36E-3014110IPR009057Homeodomain-like
SMARTSM007174.5E-131565IPR001005SANT/Myb domain
PfamPF002491.1E-141663IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.3E-241770IPR009057Homeodomain-like
CDDcd001671.74E-91863No hitNo description
PROSITE profilePS5129426.13964118IPR017930Myb domain
SMARTSM007178.7E-1568116IPR001005SANT/Myb domain
PfamPF002496.9E-1669114IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.7E-2771118IPR009057Homeodomain-like
CDDcd001673.87E-1071114No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006357Biological Processregulation of transcription from RNA polymerase II promoter
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0030154Biological Processcell differentiation
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:2000652Biological Processregulation of secondary cell wall biogenesis
GO:0005634Cellular Componentnucleus
GO:0000981Molecular FunctionRNA polymerase II transcription factor activity, sequence-specific DNA binding
GO:0001135Molecular Functiontranscription factor activity, RNA polymerase II transcription factor recruiting
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000230anatomyinflorescence meristem
PO:0000272anatomyprotoxylem
PO:0005352anatomyxylem
PO:0009005anatomyroot
PO:0009046anatomyflower
PO:0025281anatomypollen
PO:0007611developmental stagepetal differentiation and expansion stage
Sequence ? help Back to Top
Protein Sequence    Length: 294 aa     Download sequence    Send to blast
MGKGRAPCCD KTKVKRGPWS PEEDIKLISF IQKFGHENWR SLPKQSGLLR CGKSCRLRWI  60
NYLRPDLKRG NFTSEEEETI IKLHHNYGNK WSKIASQLPG RTDNEIKNVW HTHLKKRLAQ  120
SSGTADEPAS PCSSDSVSRG KDDKSSHVED SLNRETNHRN ELSTSMSSGG SNQQDDPKID  180
ELRFEYIEEA YSEFNDIIIQ EVDKPDLLEI PFDSDPDIWS FLDTSNSFQQ STANENSSGS  240
RATTEEESDE DEVKKWFKHL ESELGLEEDD NQQQYKEEES SSSSLLKNYE LMIH
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A7e-25161184105MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO1453377430.0
Genevisible264119_at0.0
Expression AtlasAT1G79180-
AtGenExpressAT1G79180-
ATTED-IIAT1G79180-
Functional Description ? help Back to Top
Source Description
TAIRMember of the R2R3 factor gene family.
Function -- GeneRIF ? help Back to Top
  1. MYB58 and MYB63 are specifically expressed in fibers and vessels undergoing secondary wall thickening, and are transcriptional activators of lignin biosynthesis.
    [PMID: 19122102]
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00249DAP27203113Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT1G79180.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Regulation -- ATRM (Manually Curated Upstream Regulators) ? help Back to Top
Source Upstream Regulator (A: Activate/R: Repress)
ATRM AT1G32770 (A), AT1G71930 (A), AT2G46770 (A), AT3G61910 (A), AT5G12870 (A), AT5G62380 (A)
Regulation -- ATRM (Manually Curated Target Genes) ? help Back to Top
Source Target Gene (A: Activate/R: Repress)
ATRM AT1G15950(A), AT1G51680(A), AT2G30490(A), AT2G37040(A), AT2G38080(A), AT2G40890(A), AT4G34050(A), AT4G37970(A), AT5G48930(A), AT5G54160(A)
Regulation -- Hormone ? help Back to Top
Source Hormone
AHDjasmonic acid, salicylic acid
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT1G79180
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY5195720.0AY519572.1 Arabidopsis thaliana MYB transcription factor (At1g79180) mRNA, complete cds.
GenBankBT0331250.0BT033125.1 Arabidopsis thaliana unknown protein (At1g79180) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_178039.10.0myb domain protein 63
TrEMBLQ6R0A60.0Q6R0A6_ARATH; At1g79180
STRINGAT1G79180.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Representative plantOGRP5171784
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Stracke R,Werber M,Weisshaar B
    The R2R3-MYB gene family in Arabidopsis thaliana.
    Curr. Opin. Plant Biol., 2001. 4(5): p. 447-56
    [PMID:11597504]
  3. Guan Y,Nothnagel EA
    Binding of arabinogalactan proteins by Yariv phenylglycoside triggers wound-like responses in Arabidopsis cell cultures.
    Plant Physiol., 2004. 135(3): p. 1346-66
    [PMID:15235117]
  4. Ehlting J, et al.
    Global transcript profiling of primary stems from Arabidopsis thaliana identifies candidate genes for missing links in lignin biosynthesis and transcriptional regulators of fiber differentiation.
    Plant J., 2005. 42(5): p. 618-40
    [PMID:15918878]
  5. Yanhui C, et al.
    The MYB transcription factor superfamily of Arabidopsis: expression analysis and phylogenetic comparison with the rice MYB family.
    Plant Mol. Biol., 2006. 60(1): p. 107-24
    [PMID:16463103]
  6. Ditt RF, et al.
    The Arabidopsis thaliana transcriptome in response to Agrobacterium tumefaciens.
    Mol. Plant Microbe Interact., 2006. 19(6): p. 665-81
    [PMID:16776300]
  7. Zhou J,Lee C,Zhong R,Ye ZH
    MYB58 and MYB63 are transcriptional activators of the lignin biosynthetic pathway during secondary cell wall formation in Arabidopsis.
    Plant Cell, 2009. 21(1): p. 248-66
    [PMID:19122102]
  8. Ko JH,Kim WC,Han KH
    Ectopic expression of MYB46 identifies transcriptional regulatory genes involved in secondary wall biosynthesis in Arabidopsis.
    Plant J., 2009. 60(4): p. 649-65
    [PMID:19674407]
  9. Zhong R,Ye ZH
    Transcriptional regulation of lignin biosynthesis.
    Plant Signal Behav, 2009. 4(11): p. 1028-34
    [PMID:19838072]
  10. Bhargava A,Mansfield SD,Hall HC,Douglas CJ,Ellis BE
    MYB75 functions in regulation of secondary cell wall formation in the Arabidopsis inflorescence stem.
    Plant Physiol., 2010. 154(3): p. 1428-38
    [PMID:20807862]
  11. Zhong R,Ye ZH
    MYB46 and MYB83 bind to the SMRE sites and directly activate a suite of transcription factors and secondary wall biosynthetic genes.
    Plant Cell Physiol., 2012. 53(2): p. 368-80
    [PMID:22197883]
  12. Yan L, et al.
    The heterologous expression in Arabidopsis thaliana of sorghum transcription factor SbbHLH1 downregulates lignin synthesis.
    J. Exp. Bot., 2013. 64(10): p. 3021-32
    [PMID:23698629]
  13. Jin J, et al.
    An Arabidopsis Transcriptional Regulatory Map Reveals Distinct Functional and Evolutionary Features of Novel Transcription Factors.
    Mol. Biol. Evol., 2015. 32(7): p. 1767-73
    [PMID:25750178]